Anti-TYMS antibody produced in rabbit

NA.41

TYMS codes for thymidylate synthetase that catalyzes the methylation of deoxyuridylate to deoxythymidylate. This reaction maintain the dTMP pool for DNA replications and repair. Variations in TYMS have been implicated in fluoropyrimidine toxicity.
Rabbit Anti-TYMS antibody recognizes bovine, human, mouse, and rat TYMS.

Synthetic peptide directed towards the C terminal region of human TYMS

Rabbit Anti-TYMS antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-47 CR601528.1 1-47 48-1099 X02308.1 14-1065 1100-1603 BC083512.1 1067-1570

Synthetic peptide located within the following region: HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

36 kDa

rat, dog, mouse, bovine, pig, human

0.5 mg - 1 mg/mL

western blot: suitable

NP_001062

P04818

wet ice

−20℃

human ... TYMS(7298)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3