Anti-RNF10 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human RNF10

RNF10 contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known. The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known.

Synthetic peptide located within the following region: PPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELSYPKNESFNNQSRRSS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

90 kDa

human, dog, mouse, horse, rat, bovine

0.5 mg - 1 mg/mL

western blot: suitable

Q8N5U6

wet ice

−20℃

human ... RNF10(9921)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3