Anti-LRRC70 antibody produced in rabbit

HPA013409    Human Protein Atlas characterization data

The gene LRRC70 (leucine rich repeat containing 70) is mapped to human chromosome 5q12. It is expressed in smooth muscle, brain, uterus, pancreas, cartilage, adipose, spleen, and testis at low levels.

leucine rich repeat containing 70 recombinant protein epitope signature tag (PrEST)

Anti-LRRC70 antibody produced in rabbit has been used for the protein neoplastic biomarkers for cervix and uterine cancer.
Anti-LRRC70 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The gene LRRC70 (leucine rich repeat containing 70) is also called as SLRN (Synleurin) and encodes a single span transmembrane leucine-rich repeat (LRR) protein that contains an extracellular domain with LRR cassette. The protein enhances cell′s response to cytokine stimulation.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72367.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:20- 1:50

PLSSLIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKSPHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQL

Q7Z2Q7

wet ice

−20℃

human ... LRRC70(100130733)

10 - Combustible liquids

WGK 1